Protein Description: reelin
Gene Name: RELN
Alternative Gene Name: PRO1598, RL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042453: 97%, ENSRNOG00000021441: 96%
Entrez Gene ID: 5649
Uniprot ID: P78509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RELN
Alternative Gene Name: PRO1598, RL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042453: 97%, ENSRNOG00000021441: 96%
Entrez Gene ID: 5649
Uniprot ID: P78509
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QYSNDNGILWHLLRELDFMSFLEPQIISIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSIDLQANWYRIQGGQVDIDCL |
| Documents & Links for Anti RELN pAb (ATL-HPA077891) | |
| Datasheet | Anti RELN pAb (ATL-HPA077891) Datasheet (External Link) |
| Vendor Page | Anti RELN pAb (ATL-HPA077891) at Atlas |
| Documents & Links for Anti RELN pAb (ATL-HPA077891) | |
| Datasheet | Anti RELN pAb (ATL-HPA077891) Datasheet (External Link) |
| Vendor Page | Anti RELN pAb (ATL-HPA077891) |