Protein Description: receptor accessory protein 5
Gene Name: REEP5
Alternative Gene Name: C5orf18, D5S346, DP1, TB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005873: 84%, ENSRNOG00000020167: 86%
Entrez Gene ID: 7905
Uniprot ID: Q00765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: REEP5
Alternative Gene Name: C5orf18, D5S346, DP1, TB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005873: 84%, ENSRNOG00000020167: 86%
Entrez Gene ID: 7905
Uniprot ID: Q00765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEE |
| Documents & Links for Anti REEP5 pAb (ATL-HPA069960) | |
| Datasheet | Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link) |
| Vendor Page | Anti REEP5 pAb (ATL-HPA069960) at Atlas |
| Documents & Links for Anti REEP5 pAb (ATL-HPA069960) | |
| Datasheet | Anti REEP5 pAb (ATL-HPA069960) Datasheet (External Link) |
| Vendor Page | Anti REEP5 pAb (ATL-HPA069960) |