Anti RECQL pAb (ATL-HPA064259)

Atlas Antibodies

Catalog No: ATL-HPA064259-25

• 
• 

Product Description

Protein Description: RecQ helicase-like
Gene Name: RECQL
Alternative Gene Name: RecQ1, RecQL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030243: 87%, ENSRNOG00000012602: 87%
Entrez Gene ID: 5965
Uniprot ID: P46063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQ
• Gene Sequence: ISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQ
• Gene ID - Mouse: ENSMUSG00000030243
• Gene ID - Rat: ENSRNOG00000012602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.