Anti RECK pAb (ATL-HPA071729)

Atlas Antibodies

Catalog No: ATL-HPA071729-25

• 

Product Description

Protein Description: reversion-inducing-cysteine-rich protein with kazal motifs
Gene Name: RECK
Alternative Gene Name: hRECK, ST15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028476: 91%, ENSRNOG00000014863: 89%
Entrez Gene ID: 8434
Uniprot ID: O95980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
• Gene Sequence: IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
• Gene ID - Mouse: ENSMUSG00000028476
• Gene ID - Rat: ENSRNOG00000014863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.