Protein Description: reversion-inducing-cysteine-rich protein with kazal motifs
Gene Name: RECK
Alternative Gene Name: hRECK, ST15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028476: 91%, ENSRNOG00000014863: 89%
Entrez Gene ID: 8434
Uniprot ID: O95980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RECK
Alternative Gene Name: hRECK, ST15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028476: 91%, ENSRNOG00000014863: 89%
Entrez Gene ID: 8434
Uniprot ID: O95980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC |
Documents & Links for Anti RECK pAb (ATL-HPA071729) | |
Datasheet | Anti RECK pAb (ATL-HPA071729) Datasheet (External Link) |
Vendor Page | Anti RECK pAb (ATL-HPA071729) at Atlas |
Documents & Links for Anti RECK pAb (ATL-HPA071729) | |
Datasheet | Anti RECK pAb (ATL-HPA071729) Datasheet (External Link) |
Vendor Page | Anti RECK pAb (ATL-HPA071729) |