Protein Description: RAD52 motif containing 1
Gene Name: RDM1
Alternative Gene Name: MGC33977, RAD52B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010362: 78%, ENSRNOG00000020751: 78%
Entrez Gene ID: 201299
Uniprot ID: Q8NG50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RDM1
Alternative Gene Name: MGC33977, RAD52B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010362: 78%, ENSRNOG00000020751: 78%
Entrez Gene ID: 201299
Uniprot ID: Q8NG50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHR |
Documents & Links for Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) | |
Datasheet | Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) at Atlas |
Documents & Links for Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) | |
Datasheet | Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RDM1 pAb (ATL-HPA067546 w/enhanced validation) |