Protein Description: retinol dehydrogenase 8 (all-trans)
Gene Name: RDH8
Alternative Gene Name: PRRDH, SDR28C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053773: 72%, ENSRNOG00000025767: 75%
Entrez Gene ID: 50700
Uniprot ID: Q9NYR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RDH8
Alternative Gene Name: PRRDH, SDR28C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053773: 72%, ENSRNOG00000025767: 75%
Entrez Gene ID: 50700
Uniprot ID: Q9NYR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VQAIVNVISSTRPPLRRQTNIRYSPLTTLKTVDSSGSLYVRTTHRLLFRCPRLLNLGLQCL |
| Documents & Links for Anti RDH8 pAb (ATL-HPA064473) | |
| Datasheet | Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link) |
| Vendor Page | Anti RDH8 pAb (ATL-HPA064473) at Atlas |
| Documents & Links for Anti RDH8 pAb (ATL-HPA064473) | |
| Datasheet | Anti RDH8 pAb (ATL-HPA064473) Datasheet (External Link) |
| Vendor Page | Anti RDH8 pAb (ATL-HPA064473) |