Anti RDH5 pAb (ATL-HPA063345)

Catalog No:
ATL-HPA063345-25
$447.00

Description

Product Description

Protein Description: retinol dehydrogenase 5 (11-cis/9-cis)
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene Sequence NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene ID - Mouse ENSMUSG00000025350
Gene ID - Rat ENSRNOG00000053850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345) at Atlas Antibodies

Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345)

Product Description

Protein Description: retinol dehydrogenase 5 (11-cis/9-cis)
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene Sequence NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL
Gene ID - Mouse ENSMUSG00000025350
Gene ID - Rat ENSRNOG00000053850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345) at Atlas Antibodies

Documents & Links for Anti RDH5 pAb (ATL-HPA063345)
Datasheet Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link)
Vendor Page Anti RDH5 pAb (ATL-HPA063345)