Protein Description: retinol dehydrogenase 5 (11-cis/9-cis)
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RDH5
Alternative Gene Name: HSD17B9, RDH1, SDR9C5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025350: 92%, ENSRNOG00000053850: 95%
Entrez Gene ID: 5959
Uniprot ID: Q92781
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL |
| Documents & Links for Anti RDH5 pAb (ATL-HPA063345) | |
| Datasheet | Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link) |
| Vendor Page | Anti RDH5 pAb (ATL-HPA063345) at Atlas |
| Documents & Links for Anti RDH5 pAb (ATL-HPA063345) | |
| Datasheet | Anti RDH5 pAb (ATL-HPA063345) Datasheet (External Link) |
| Vendor Page | Anti RDH5 pAb (ATL-HPA063345) |