Anti RCSD1 pAb (ATL-HPA073490)

Atlas Antibodies

Catalog No: ATL-HPA073490-25

• 

Product Description

Protein Description: RCSD domain containing 1
Gene Name: RCSD1
Alternative Gene Name: CapZIP, MGC21854, MK2S4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040723: 86%, ENSRNOG00000003283: 88%
Entrez Gene ID: 92241
Uniprot ID: Q6JBY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL
• Gene Sequence: MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL
• Gene ID - Mouse: ENSMUSG00000040723
• Gene ID - Rat: ENSRNOG00000003283
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.