Protein Description: RNA terminal phosphate cyclase-like 1
Gene Name: RCL1
Alternative Gene Name: RNAC, RPCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024785: 96%, ENSRNOG00000015491: 96%
Entrez Gene ID: 10171
Uniprot ID: Q9Y2P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RCL1
Alternative Gene Name: RNAC, RPCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024785: 96%, ENSRNOG00000015491: 96%
Entrez Gene ID: 10171
Uniprot ID: Q9Y2P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGK |
Documents & Links for Anti RCL1 pAb (ATL-HPA071308) | |
Datasheet | Anti RCL1 pAb (ATL-HPA071308) Datasheet (External Link) |
Vendor Page | Anti RCL1 pAb (ATL-HPA071308) at Atlas |
Documents & Links for Anti RCL1 pAb (ATL-HPA071308) | |
Datasheet | Anti RCL1 pAb (ATL-HPA071308) Datasheet (External Link) |
Vendor Page | Anti RCL1 pAb (ATL-HPA071308) |