Anti RBMS1 pAb (ATL-HPA061791)

Atlas Antibodies

Catalog No: ATL-HPA061791-100

• 
• 

Product Description

Protein Description: RNA binding motif, single stranded interacting protein 1
Gene Name: RBMS1
Alternative Gene Name: C2orf12, DKFZp564H0764, HCC-4, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026970: 100%, ENSRNOG00000008482: 100%
Entrez Gene ID: 5937
Uniprot ID: P29558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP
• Gene Sequence: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP
• Gene ID - Mouse: ENSMUSG00000026970
• Gene ID - Rat: ENSRNOG00000008482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.