Protein Description: RNA binding motif protein 46
Gene Name: RBM46
Alternative Gene Name: CT68, MGC27016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033882: 100%, ENSRNOG00000025823: 100%
Entrez Gene ID: 166863
Uniprot ID: Q8TBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RBM46
Alternative Gene Name: CT68, MGC27016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033882: 100%, ENSRNOG00000025823: 100%
Entrez Gene ID: 166863
Uniprot ID: Q8TBY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FNSAVMHLDYYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAA |
Documents & Links for Anti RBM46 pAb (ATL-HPA079488) | |
Datasheet | Anti RBM46 pAb (ATL-HPA079488) Datasheet (External Link) |
Vendor Page | Anti RBM46 pAb (ATL-HPA079488) at Atlas |
Documents & Links for Anti RBM46 pAb (ATL-HPA079488) | |
Datasheet | Anti RBM46 pAb (ATL-HPA079488) Datasheet (External Link) |
Vendor Page | Anti RBM46 pAb (ATL-HPA079488) |