Protein Description: RNA binding motif protein 24
Gene Name: RBM24
Alternative Gene Name: dJ259A10.1, FLJ30829, RNPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038132: 100%, ENSRNOG00000046547: 100%
Entrez Gene ID: 221662
Uniprot ID: Q9BX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RBM24
Alternative Gene Name: dJ259A10.1, FLJ30829, RNPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038132: 100%, ENSRNOG00000046547: 100%
Entrez Gene ID: 221662
Uniprot ID: Q9BX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA |
Documents & Links for Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) | |
Datasheet | Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) at Atlas |
Documents & Links for Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) | |
Datasheet | Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation) |