Anti RBM24 pAb (ATL-HPA066927 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA066927-25

• 
• 

Product Description

Protein Description: RNA binding motif protein 24
Gene Name: RBM24
Alternative Gene Name: dJ259A10.1, FLJ30829, RNPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038132: 100%, ENSRNOG00000046547: 100%
Entrez Gene ID: 221662
Uniprot ID: Q9BX46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA
• Gene Sequence: PALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTA
• Gene ID - Mouse: ENSMUSG00000038132
• Gene ID - Rat: ENSRNOG00000046547
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.