![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101527/181651/atl-hpa075862_anti-rbfox3-pab-atl-hpa075862_63319__02535.1681138026.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: RNA binding fox-1 homolog 3
Gene Name: RBFOX3
Alternative Gene Name: FOX-3, HRNBP3, NeuN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008658: 100%, ENSRNOG00000003386: 100%
Entrez Gene ID: 146713
Uniprot ID: A6NFN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RBFOX3
Alternative Gene Name: FOX-3, HRNBP3, NeuN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008658: 100%, ENSRNOG00000003386: 100%
Entrez Gene ID: 146713
Uniprot ID: A6NFN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS |
| Documents & Links for Anti RBFOX3 pAb (ATL-HPA075862) | |
| Datasheet | Anti RBFOX3 pAb (ATL-HPA075862) Datasheet (External Link) |
| Vendor Page | Anti RBFOX3 pAb (ATL-HPA075862) at Atlas |
| Documents & Links for Anti RBFOX3 pAb (ATL-HPA075862) | |
| Datasheet | Anti RBFOX3 pAb (ATL-HPA075862) Datasheet (External Link) |
| Vendor Page | Anti RBFOX3 pAb (ATL-HPA075862) |