Protein Description: Ras association domain family member 4
Gene Name: RASSF4
Alternative Gene Name: AD037, MGC44914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042129: 88%, ENSRNOG00000013526: 88%
Entrez Gene ID: 83937
Uniprot ID: Q9H2L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RASSF4
Alternative Gene Name: AD037, MGC44914
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042129: 88%, ENSRNOG00000013526: 88%
Entrez Gene ID: 83937
Uniprot ID: Q9H2L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DGPSEFALYIVHESGERTKLKDCEYPLISRILHGPCEKIARIFLMEADLGV |
Documents & Links for Anti RASSF4 pAb (ATL-HPA077069) | |
Datasheet | Anti RASSF4 pAb (ATL-HPA077069) Datasheet (External Link) |
Vendor Page | Anti RASSF4 pAb (ATL-HPA077069) at Atlas |
Documents & Links for Anti RASSF4 pAb (ATL-HPA077069) | |
Datasheet | Anti RASSF4 pAb (ATL-HPA077069) Datasheet (External Link) |
Vendor Page | Anti RASSF4 pAb (ATL-HPA077069) |