Anti RASL10B pAb (ATL-HPA057092)

Atlas Antibodies

Catalog No: ATL-HPA057092-25

• 
• 

Product Description

Protein Description: RAS-like, family 10, member B
Gene Name: RASL10B
Alternative Gene Name: RRP17, VTS58635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020684: 98%, ENSRNOG00000055765: 100%
Entrez Gene ID: 91608
Uniprot ID: Q96S79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
• Gene Sequence: KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
• Gene ID - Mouse: ENSMUSG00000020684
• Gene ID - Rat: ENSRNOG00000055765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.