Protein Description: Ras interacting protein 1
Gene Name: RASIP1
Alternative Gene Name: FLJ20401, RAIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044562: 97%, ENSRNOG00000021004: 97%
Entrez Gene ID: 54922
Uniprot ID: Q5U651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RASIP1
Alternative Gene Name: FLJ20401, RAIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044562: 97%, ENSRNOG00000021004: 97%
Entrez Gene ID: 54922
Uniprot ID: Q5U651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRP |
| Documents & Links for Anti RASIP1 pAb (ATL-HPA077251) | |
| Datasheet | Anti RASIP1 pAb (ATL-HPA077251) Datasheet (External Link) |
| Vendor Page | Anti RASIP1 pAb (ATL-HPA077251) at Atlas |
| Documents & Links for Anti RASIP1 pAb (ATL-HPA077251) | |
| Datasheet | Anti RASIP1 pAb (ATL-HPA077251) Datasheet (External Link) |
| Vendor Page | Anti RASIP1 pAb (ATL-HPA077251) |