Description
Product Description
Protein Description: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Gene Name: RASGRP3
Alternative Gene Name: GRP3, KIAA0846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071042: 93%, ENSRNOG00000032703: 93%
Entrez Gene ID: 25780
Uniprot ID: Q8IV61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RASGRP3
Alternative Gene Name: GRP3, KIAA0846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071042: 93%, ENSRNOG00000032703: 93%
Entrez Gene ID: 25780
Uniprot ID: Q8IV61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE |
Gene Sequence | RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE |
Gene ID - Mouse | ENSMUSG00000071042 |
Gene ID - Rat | ENSRNOG00000032703 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937) | |
Datasheet | Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link) |
Vendor Page | Anti RASGRP3 pAb (ATL-HPA058937) at Atlas Antibodies |
Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937) | |
Datasheet | Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link) |
Vendor Page | Anti RASGRP3 pAb (ATL-HPA058937) |