Anti RASGRP3 pAb (ATL-HPA058937)

Catalog No:
ATL-HPA058937-25
$447.00

Description

Product Description

Protein Description: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Gene Name: RASGRP3
Alternative Gene Name: GRP3, KIAA0846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071042: 93%, ENSRNOG00000032703: 93%
Entrez Gene ID: 25780
Uniprot ID: Q8IV61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE
Gene Sequence RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE
Gene ID - Mouse ENSMUSG00000071042
Gene ID - Rat ENSRNOG00000032703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937)
Datasheet Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link)
Vendor Page Anti RASGRP3 pAb (ATL-HPA058937) at Atlas Antibodies

Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937)
Datasheet Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link)
Vendor Page Anti RASGRP3 pAb (ATL-HPA058937)

Product Description

Protein Description: RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Gene Name: RASGRP3
Alternative Gene Name: GRP3, KIAA0846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071042: 93%, ENSRNOG00000032703: 93%
Entrez Gene ID: 25780
Uniprot ID: Q8IV61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE
Gene Sequence RYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLE
Gene ID - Mouse ENSMUSG00000071042
Gene ID - Rat ENSRNOG00000032703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937)
Datasheet Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link)
Vendor Page Anti RASGRP3 pAb (ATL-HPA058937) at Atlas Antibodies

Documents & Links for Anti RASGRP3 pAb (ATL-HPA058937)
Datasheet Anti RASGRP3 pAb (ATL-HPA058937) Datasheet (External Link)
Vendor Page Anti RASGRP3 pAb (ATL-HPA058937)