Protein Description: RAS and EF-hand domain containing
Gene Name: RASEF
Alternative Gene Name: FLJ31614, RAB45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043003: 75%, ENSRNOG00000024190: 71%
Entrez Gene ID: 158158
Uniprot ID: Q8IZ41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RASEF
Alternative Gene Name: FLJ31614, RAB45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043003: 75%, ENSRNOG00000024190: 71%
Entrez Gene ID: 158158
Uniprot ID: Q8IZ41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLSTLRDPNEYDSEVEYKHQRGFQRSHGVQESFGGDASDTDVPDIRDEETFGLEDVASVLDWKPQGSVSEGSIVSSSRKPISAL |
| Documents & Links for Anti RASEF pAb (ATL-HPA078596) | |
| Datasheet | Anti RASEF pAb (ATL-HPA078596) Datasheet (External Link) |
| Vendor Page | Anti RASEF pAb (ATL-HPA078596) at Atlas |
| Documents & Links for Anti RASEF pAb (ATL-HPA078596) | |
| Datasheet | Anti RASEF pAb (ATL-HPA078596) Datasheet (External Link) |
| Vendor Page | Anti RASEF pAb (ATL-HPA078596) |