Protein Description: Rap guanine nucleotide exchange factor (GEF) 5
Gene Name: RAPGEF5
Alternative Gene Name: GFR, KIAA0277, MR-GEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041992: 95%, ENSRNOG00000005271: 95%
Entrez Gene ID: 9771
Uniprot ID: Q92565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAPGEF5
Alternative Gene Name: GFR, KIAA0277, MR-GEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041992: 95%, ENSRNOG00000005271: 95%
Entrez Gene ID: 9771
Uniprot ID: Q92565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDVPRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLD |
| Documents & Links for Anti RAPGEF5 pAb (ATL-HPA076772) | |
| Datasheet | Anti RAPGEF5 pAb (ATL-HPA076772) Datasheet (External Link) |
| Vendor Page | Anti RAPGEF5 pAb (ATL-HPA076772) at Atlas |
| Documents & Links for Anti RAPGEF5 pAb (ATL-HPA076772) | |
| Datasheet | Anti RAPGEF5 pAb (ATL-HPA076772) Datasheet (External Link) |
| Vendor Page | Anti RAPGEF5 pAb (ATL-HPA076772) |