Anti RAPGEF4 pAb (ATL-HPA028968)

Atlas Antibodies

Catalog No: ATL-HPA028968-25

• 
• 
• 

Product Description

Protein Description: Rap guanine nucleotide exchange factor (GEF) 4
Gene Name: RAPGEF4
Alternative Gene Name: cAMP-GEFII, CGEF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049044: 97%, ENSRNOG00000001516: 98%
Entrez Gene ID: 11069
Uniprot ID: Q8WZA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
• Gene Sequence: VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
• Gene ID - Mouse: ENSMUSG00000049044
• Gene ID - Rat: ENSRNOG00000001516
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.