Protein Description: Rap guanine nucleotide exchange factor 2
Gene Name: RAPGEF2
Alternative Gene Name: DKFZP586O1422, KIAA0313, PDZ-GEF1, PDZGEF1, RA-GEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062232: 94%, ENSRNOG00000021581: 94%
Entrez Gene ID: 9693
Uniprot ID: Q9Y4G8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAPGEF2
Alternative Gene Name: DKFZP586O1422, KIAA0313, PDZ-GEF1, PDZGEF1, RA-GEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062232: 94%, ENSRNOG00000021581: 94%
Entrez Gene ID: 9693
Uniprot ID: Q9Y4G8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PPPAHKINQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTSP |
Documents & Links for Anti RAPGEF2 pAb (ATL-HPA068798) | |
Datasheet | Anti RAPGEF2 pAb (ATL-HPA068798) Datasheet (External Link) |
Vendor Page | Anti RAPGEF2 pAb (ATL-HPA068798) at Atlas |
Documents & Links for Anti RAPGEF2 pAb (ATL-HPA068798) | |
Datasheet | Anti RAPGEF2 pAb (ATL-HPA068798) Datasheet (External Link) |
Vendor Page | Anti RAPGEF2 pAb (ATL-HPA068798) |