Description
Product Description
Protein Description: RAN guanine nucleotide release factor
Gene Name: RANGRF
Alternative Gene Name: HSPC165, HSPC236, MOG1, RANGNRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032892: 87%, ENSRNOG00000004980: 87%
Entrez Gene ID: 29098
Uniprot ID: Q9HD47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RANGRF
Alternative Gene Name: HSPC165, HSPC236, MOG1, RANGNRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032892: 87%, ENSRNOG00000004980: 87%
Entrez Gene ID: 29098
Uniprot ID: Q9HD47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP |
Gene Sequence | VAKDVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPAPWSLGDFEQLVTSLTLHDPNIFGP |
Gene ID - Mouse | ENSMUSG00000032892 |
Gene ID - Rat | ENSRNOG00000004980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RANGRF pAb (ATL-HPA057888) | |
Datasheet | Anti RANGRF pAb (ATL-HPA057888) Datasheet (External Link) |
Vendor Page | Anti RANGRF pAb (ATL-HPA057888) at Atlas Antibodies |
Documents & Links for Anti RANGRF pAb (ATL-HPA057888) | |
Datasheet | Anti RANGRF pAb (ATL-HPA057888) Datasheet (External Link) |
Vendor Page | Anti RANGRF pAb (ATL-HPA057888) |