Description
Product Description
Protein Description: Ran GTPase activating protein 1
Gene Name: RANGAP1
Alternative Gene Name: Fug1, KIAA1835, SD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022391: 92%, ENSRNOG00000031789: 93%
Entrez Gene ID: 5905
Uniprot ID: P46060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RANGAP1
Alternative Gene Name: Fug1, KIAA1835, SD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022391: 92%, ENSRNOG00000031789: 93%
Entrez Gene ID: 5905
Uniprot ID: P46060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD |
Gene Sequence | NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD |
Gene ID - Mouse | ENSMUSG00000022391 |
Gene ID - Rat | ENSRNOG00000031789 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) | |
Datasheet | Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) | |
Datasheet | Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) |