Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation)

Catalog No:
ATL-HPA062034-25
$395.00

Description

Product Description

Protein Description: Ran GTPase activating protein 1
Gene Name: RANGAP1
Alternative Gene Name: Fug1, KIAA1835, SD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022391: 92%, ENSRNOG00000031789: 93%
Entrez Gene ID: 5905
Uniprot ID: P46060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
Gene Sequence NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
Gene ID - Mouse ENSMUSG00000022391
Gene ID - Rat ENSRNOG00000031789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation)
Datasheet Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation)

Product Description

Protein Description: Ran GTPase activating protein 1
Gene Name: RANGAP1
Alternative Gene Name: Fug1, KIAA1835, SD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022391: 92%, ENSRNOG00000031789: 93%
Entrez Gene ID: 5905
Uniprot ID: P46060
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
Gene Sequence NFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
Gene ID - Mouse ENSMUSG00000022391
Gene ID - Rat ENSRNOG00000031789
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation)
Datasheet Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RANGAP1 pAb (ATL-HPA062034 w/enhanced validation)