Protein Description: RAN binding protein 9
Gene Name: RANBP9
Alternative Gene Name: RanBPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038546: 94%, ENSRNOG00000017951: 95%
Entrez Gene ID: 10048
Uniprot ID: Q96S59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RANBP9
Alternative Gene Name: RanBPM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038546: 94%, ENSRNOG00000017951: 95%
Entrez Gene ID: 10048
Uniprot ID: Q96S59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTVMEVDSS |
Documents & Links for Anti RANBP9 pAb (ATL-HPA076784) | |
Datasheet | Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link) |
Vendor Page | Anti RANBP9 pAb (ATL-HPA076784) at Atlas |
Documents & Links for Anti RANBP9 pAb (ATL-HPA076784) | |
Datasheet | Anti RANBP9 pAb (ATL-HPA076784) Datasheet (External Link) |
Vendor Page | Anti RANBP9 pAb (ATL-HPA076784) |