Protein Description: RAN binding protein 2
Gene Name: RANBP2
Alternative Gene Name: ADANE, ANE1, NUP358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 100%, ENSRNOG00000000796: 100%
Entrez Gene ID: 5903
Uniprot ID: P49792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RANBP2
Alternative Gene Name: ADANE, ANE1, NUP358
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003226: 100%, ENSRNOG00000000796: 100%
Entrez Gene ID: 5903
Uniprot ID: P49792
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFK |
| Documents & Links for Anti RANBP2 pAb (ATL-HPA067564) | |
| Datasheet | Anti RANBP2 pAb (ATL-HPA067564) Datasheet (External Link) |
| Vendor Page | Anti RANBP2 pAb (ATL-HPA067564) at Atlas |
| Documents & Links for Anti RANBP2 pAb (ATL-HPA067564) | |
| Datasheet | Anti RANBP2 pAb (ATL-HPA067564) Datasheet (External Link) |
| Vendor Page | Anti RANBP2 pAb (ATL-HPA067564) |