Description
Product Description
Protein Description: RAN binding protein 1
Gene Name: RANBP1
Alternative Gene Name: HTF9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099164: 93%, ENSRNOG00000001884: 90%
Entrez Gene ID: 5902
Uniprot ID: P43487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RANBP1
Alternative Gene Name: HTF9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099164: 93%, ENSRNOG00000001884: 90%
Entrez Gene ID: 5902
Uniprot ID: P43487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKDTHEDHDTSTENTDESNHDPQFEPIVSL |
Gene Sequence | AKDTHEDHDTSTENTDESNHDPQFEPIVSL |
Gene ID - Mouse | ENSMUSG00000099164 |
Gene ID - Rat | ENSRNOG00000001884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) | |
Datasheet | Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) | |
Datasheet | Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti RANBP1 pAb (ATL-HPA065931 w/enhanced validation) |