Description
Product Description
Protein Description: RALY RNA binding protein-like
Gene Name: RALYL
Alternative Gene Name: HNRPCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039717: 91%, ENSRNOG00000011400: 89%
Entrez Gene ID: 138046
Uniprot ID: Q86SE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RALYL
Alternative Gene Name: HNRPCL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039717: 91%, ENSRNOG00000011400: 89%
Entrez Gene ID: 138046
Uniprot ID: Q86SE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD |
Gene Sequence | DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD |
Gene ID - Mouse | ENSMUSG00000039717 |
Gene ID - Rat | ENSRNOG00000011400 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RALYL pAb (ATL-HPA059112) | |
Datasheet | Anti RALYL pAb (ATL-HPA059112) Datasheet (External Link) |
Vendor Page | Anti RALYL pAb (ATL-HPA059112) at Atlas Antibodies |
Documents & Links for Anti RALYL pAb (ATL-HPA059112) | |
Datasheet | Anti RALYL pAb (ATL-HPA059112) Datasheet (External Link) |
Vendor Page | Anti RALYL pAb (ATL-HPA059112) |