Polyclonal Antibody against Human RALGPS1, Gene description: Ral GEF with PH domain and SH3 binding motif 1, Alternative Gene Names: KIAA0351, RALGEF2, RALGPS1A, Validated applications: IHC, Uniprot ID: Q5JS13, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES |
| Documents & Links for Anti-RALGPS1 pAb (ATL-HPA014749) | |
| Vendor Page | Anti-RALGPS1 pAb (ATL-HPA014749) at Atlas |
| Documents & Links for Anti-RALGPS1 pAb (ATL-HPA014749) | |
| Vendor Page | Anti-RALGPS1 pAb (ATL-HPA014749) |