Description
Product Description
Protein Description: recombination activating 2
Gene Name: RAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032864: 90%, ENSRNOG00000004623: 91%
Entrez Gene ID: 5897
Uniprot ID: P55895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032864: 90%, ENSRNOG00000004623: 91%
Entrez Gene ID: 5897
Uniprot ID: P55895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF |
Gene Sequence | HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF |
Gene ID - Mouse | ENSMUSG00000032864 |
Gene ID - Rat | ENSRNOG00000004623 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti RAG2 pAb (ATL-HPA065704) | |
Datasheet | Anti RAG2 pAb (ATL-HPA065704) Datasheet (External Link) |
Vendor Page | Anti RAG2 pAb (ATL-HPA065704) at Atlas Antibodies |
Documents & Links for Anti RAG2 pAb (ATL-HPA065704) | |
Datasheet | Anti RAG2 pAb (ATL-HPA065704) Datasheet (External Link) |
Vendor Page | Anti RAG2 pAb (ATL-HPA065704) |