Protein Description: RAD54 like 2
Gene Name: RAD54L2
Alternative Gene Name: ARIP4, KIAA0809, SRISNF2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040661: 94%, ENSRNOG00000013570: 94%
Entrez Gene ID: 23132
Uniprot ID: Q9Y4B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAD54L2
Alternative Gene Name: ARIP4, KIAA0809, SRISNF2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040661: 94%, ENSRNOG00000013570: 94%
Entrez Gene ID: 23132
Uniprot ID: Q9Y4B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KAFCVCCKIWNHPDVLYEALQKESLANEQDLDVEELGSAGTSARCPPQGTKGKGEDSTLASSMGEATNSKFLQGVGFNPFQERGNNIVTYEWAKDLLTNYQTG |
| Documents & Links for Anti RAD54L2 pAb (ATL-HPA077351) | |
| Datasheet | Anti RAD54L2 pAb (ATL-HPA077351) Datasheet (External Link) |
| Vendor Page | Anti RAD54L2 pAb (ATL-HPA077351) at Atlas |
| Documents & Links for Anti RAD54L2 pAb (ATL-HPA077351) | |
| Datasheet | Anti RAD54L2 pAb (ATL-HPA077351) Datasheet (External Link) |
| Vendor Page | Anti RAD54L2 pAb (ATL-HPA077351) |