Protein Description: RAB GTPase activating protein 1
Gene Name: RABGAP1
Alternative Gene Name: GAPCenA, TBC1D11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035437: 97%, ENSRNOG00000009402: 97%
Entrez Gene ID: 23637
Uniprot ID: Q9Y3P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RABGAP1
Alternative Gene Name: GAPCenA, TBC1D11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035437: 97%, ENSRNOG00000009402: 97%
Entrez Gene ID: 23637
Uniprot ID: Q9Y3P9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PLSNQLSASSTINPVPLVGLQKPEMSLPVKPGQGDSEASSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQCQIS |
| Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860) | |
| Datasheet | Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link) |
| Vendor Page | Anti RABGAP1 pAb (ATL-HPA064860) at Atlas |
| Documents & Links for Anti RABGAP1 pAb (ATL-HPA064860) | |
| Datasheet | Anti RABGAP1 pAb (ATL-HPA064860) Datasheet (External Link) |
| Vendor Page | Anti RABGAP1 pAb (ATL-HPA064860) |