Anti RAB8B pAb (ATL-HPA074534)

Atlas Antibodies

Catalog No: ATL-HPA074534-25

• 
• 

Product Description

Protein Description: RAB8B, member RAS oncogene family
Gene Name: RAB8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
• Gene Sequence: SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
• Gene ID - Mouse: ENSMUSG00000036943
• Gene ID - Rat: ENSRNOG00000018009
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.