Protein Description: RAB8B, member RAS oncogene family
Gene Name: RAB8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAB8B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036943: 94%, ENSRNOG00000018009: 94%
Entrez Gene ID: 51762
Uniprot ID: Q92930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL |
| Documents & Links for Anti RAB8B pAb (ATL-HPA074534) | |
| Datasheet | Anti RAB8B pAb (ATL-HPA074534) Datasheet (External Link) |
| Vendor Page | Anti RAB8B pAb (ATL-HPA074534) at Atlas |
| Documents & Links for Anti RAB8B pAb (ATL-HPA074534) | |
| Datasheet | Anti RAB8B pAb (ATL-HPA074534) Datasheet (External Link) |
| Vendor Page | Anti RAB8B pAb (ATL-HPA074534) |