Protein Description: RAB20, member RAS oncogene family
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031504: 80%, ENSRNOG00000023991: 74%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: RAB20
Alternative Gene Name: FLJ20429
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031504: 80%, ENSRNOG00000023991: 74%
Entrez Gene ID: 55647
Uniprot ID: Q9NX57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA |
| Documents & Links for Anti RAB20 pAb (ATL-HPA068647) | |
| Datasheet | Anti RAB20 pAb (ATL-HPA068647) Datasheet (External Link) |
| Vendor Page | Anti RAB20 pAb (ATL-HPA068647) at Atlas |
| Documents & Links for Anti RAB20 pAb (ATL-HPA068647) | |
| Datasheet | Anti RAB20 pAb (ATL-HPA068647) Datasheet (External Link) |
| Vendor Page | Anti RAB20 pAb (ATL-HPA068647) |