Protein Description: R3H domain and coiled-coil containing 1
Gene Name: R3HCC1
Alternative Gene Name: DKFZp564N123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034194: 89%, ENSRNOG00000016777: 87%
Entrez Gene ID: 203069
Uniprot ID: Q9Y3T6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: R3HCC1
Alternative Gene Name: DKFZp564N123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034194: 89%, ENSRNOG00000016777: 87%
Entrez Gene ID: 203069
Uniprot ID: Q9Y3T6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEGWKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQG |
| Documents & Links for Anti R3HCC1 pAb (ATL-HPA023153) | |
| Datasheet | Anti R3HCC1 pAb (ATL-HPA023153) Datasheet (External Link) |
| Vendor Page | Anti R3HCC1 pAb (ATL-HPA023153) at Atlas |
| Documents & Links for Anti R3HCC1 pAb (ATL-HPA023153) | |
| Datasheet | Anti R3HCC1 pAb (ATL-HPA023153) Datasheet (External Link) |
| Vendor Page | Anti R3HCC1 pAb (ATL-HPA023153) |