Description
Product Description
Protein Description: quinolinate phosphoribosyltransferase
Gene Name: QPRT
Alternative Gene Name: QPRTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030674: 81%, ENSRNOG00000016980: 78%
Entrez Gene ID: 23475
Uniprot ID: Q15274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: QPRT
Alternative Gene Name: QPRTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030674: 81%, ENSRNOG00000016980: 78%
Entrez Gene ID: 23475
Uniprot ID: Q15274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI |
Gene Sequence | LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI |
Gene ID - Mouse | ENSMUSG00000030674 |
Gene ID - Rat | ENSRNOG00000016980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) | |
Datasheet | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) | |
Datasheet | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) |