![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101553/181680/atl-hpa076010_anti-qprt-pab-atl-hpa076010-wenhanced-validation_63348__38413.1681138061.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: quinolinate phosphoribosyltransferase
Gene Name: QPRT
Alternative Gene Name: QPRTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030674: 81%, ENSRNOG00000016980: 78%
Entrez Gene ID: 23475
Uniprot ID: Q15274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: QPRT
Alternative Gene Name: QPRTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030674: 81%, ENSRNOG00000016980: 78%
Entrez Gene ID: 23475
Uniprot ID: Q15274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKI |
| Documents & Links for Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) | |
| Datasheet | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) at Atlas |
| Documents & Links for Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) | |
| Datasheet | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QPRT pAb (ATL-HPA076010 w/enhanced validation) |