Protein Description: quinoid dihydropteridine reductase
Gene Name: QDPR
Alternative Gene Name: DHPR, PKU2, SDR33C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015806: 91%, ENSRNOG00000003253: 96%
Entrez Gene ID: 5860
Uniprot ID: P09417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: QDPR
Alternative Gene Name: DHPR, PKU2, SDR33C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015806: 91%, ENSRNOG00000003253: 96%
Entrez Gene ID: 5860
Uniprot ID: P09417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKH |
| Documents & Links for Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) | |
| Datasheet | Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) at Atlas |
| Documents & Links for Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) | |
| Datasheet | Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) |
| Citations for Anti QDPR pAb (ATL-HPA065649 w/enhanced validation) – 1 Found |
| Mathys, Hansruedi; Davila-Velderrain, Jose; Peng, Zhuyu; Gao, Fan; Mohammadi, Shahin; Young, Jennie Z; Menon, Madhvi; He, Liang; Abdurrob, Fatema; Jiang, Xueqiao; Martorell, Anthony J; Ransohoff, Richard M; Hafler, Brian P; Bennett, David A; Kellis, Manolis; Tsai, Li-Huei. Single-cell transcriptomic analysis of Alzheimer's disease. Nature. 2019;570(7761):332-337. PubMed |