Anti QDPR pAb (ATL-HPA058951 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA058951-25

• 
• 
• 

Product Description

Protein Description: quinoid dihydropteridine reductase
Gene Name: QDPR
Alternative Gene Name: DHPR, PKU2, SDR33C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015806: 94%, ENSRNOG00000003253: 92%
Entrez Gene ID: 5860
Uniprot ID: P09417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTEL
• Gene Sequence: SLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTEL
• Gene ID - Mouse: ENSMUSG00000015806
• Gene ID - Rat: ENSRNOG00000003253
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.