Description
Product Description
Protein Description: pyridine nucleotide-disulphide oxidoreductase domain 2
Gene Name: PYROXD2
Alternative Gene Name: C10orf33, FLJ23849
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060224: 92%, ENSRNOG00000015807: 95%
Entrez Gene ID: 84795
Uniprot ID: Q8N2H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PYROXD2
Alternative Gene Name: C10orf33, FLJ23849
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060224: 92%, ENSRNOG00000015807: 95%
Entrez Gene ID: 84795
Uniprot ID: Q8N2H3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLTAPITKVLDQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTE |
Gene Sequence | VLTAPITKVLDQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTE |
Gene ID - Mouse | ENSMUSG00000060224 |
Gene ID - Rat | ENSRNOG00000015807 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti PYROXD2 pAb (ATL-HPA067394) | |
Datasheet | Anti PYROXD2 pAb (ATL-HPA067394) Datasheet (External Link) |
Vendor Page | Anti PYROXD2 pAb (ATL-HPA067394) at Atlas Antibodies |
Documents & Links for Anti PYROXD2 pAb (ATL-HPA067394) | |
Datasheet | Anti PYROXD2 pAb (ATL-HPA067394) Datasheet (External Link) |
Vendor Page | Anti PYROXD2 pAb (ATL-HPA067394) |