Protein Description: pygopus family PHD finger 2
Gene Name: PYGO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047824: 97%, ENSRNOG00000020663: 96%
Entrez Gene ID: 90780
Uniprot ID: Q9BRQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PYGO2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047824: 97%, ENSRNOG00000020663: 96%
Entrez Gene ID: 90780
Uniprot ID: Q9BRQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPF |
| Documents & Links for Anti PYGO2 pAb (ATL-HPA074813) | |
| Datasheet | Anti PYGO2 pAb (ATL-HPA074813) Datasheet (External Link) |
| Vendor Page | Anti PYGO2 pAb (ATL-HPA074813) at Atlas |
| Documents & Links for Anti PYGO2 pAb (ATL-HPA074813) | |
| Datasheet | Anti PYGO2 pAb (ATL-HPA074813) Datasheet (External Link) |
| Vendor Page | Anti PYGO2 pAb (ATL-HPA074813) |