Protein Description: pyrroline-5-carboxylate reductase-like
Gene Name: PYCRL
Alternative Gene Name: FLJ13852
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022571: 82%, ENSRNOG00000054724: 82%
Entrez Gene ID: 65263
Uniprot ID: Q53H96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PYCRL
Alternative Gene Name: FLJ13852
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022571: 82%, ENSRNOG00000054724: 82%
Entrez Gene ID: 65263
Uniprot ID: Q53H96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSR |
| Documents & Links for Anti PYCRL pAb (ATL-HPA069706) | |
| Datasheet | Anti PYCRL pAb (ATL-HPA069706) Datasheet (External Link) |
| Vendor Page | Anti PYCRL pAb (ATL-HPA069706) at Atlas |
| Documents & Links for Anti PYCRL pAb (ATL-HPA069706) | |
| Datasheet | Anti PYCRL pAb (ATL-HPA069706) Datasheet (External Link) |
| Vendor Page | Anti PYCRL pAb (ATL-HPA069706) |