Anti PWWP2B pAb (ATL-HPA078118)

Catalog No:
ATL-HPA078118-25
$447.00

Description

Product Description

Protein Description: PWWP domain containing 2B
Gene Name: PWWP2B
Alternative Gene Name: bA432J24.1, FLJ46823, PWWP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060260: 79%, ENSRNOG00000036649: 77%
Entrez Gene ID: 170394
Uniprot ID: Q6NUJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Gene Sequence VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Gene ID - Mouse ENSMUSG00000060260
Gene ID - Rat ENSRNOG00000036649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PWWP2B pAb (ATL-HPA078118)
Datasheet Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link)
Vendor Page Anti PWWP2B pAb (ATL-HPA078118) at Atlas Antibodies

Documents & Links for Anti PWWP2B pAb (ATL-HPA078118)
Datasheet Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link)
Vendor Page Anti PWWP2B pAb (ATL-HPA078118)

Product Description

Protein Description: PWWP domain containing 2B
Gene Name: PWWP2B
Alternative Gene Name: bA432J24.1, FLJ46823, PWWP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060260: 79%, ENSRNOG00000036649: 77%
Entrez Gene ID: 170394
Uniprot ID: Q6NUJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Gene Sequence VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Gene ID - Mouse ENSMUSG00000060260
Gene ID - Rat ENSRNOG00000036649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PWWP2B pAb (ATL-HPA078118)
Datasheet Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link)
Vendor Page Anti PWWP2B pAb (ATL-HPA078118) at Atlas Antibodies

Documents & Links for Anti PWWP2B pAb (ATL-HPA078118)
Datasheet Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link)
Vendor Page Anti PWWP2B pAb (ATL-HPA078118)