Protein Description: PWWP domain containing 2B
Gene Name: PWWP2B
Alternative Gene Name: bA432J24.1, FLJ46823, PWWP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060260: 79%, ENSRNOG00000036649: 77%
Entrez Gene ID: 170394
Uniprot ID: Q6NUJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PWWP2B
Alternative Gene Name: bA432J24.1, FLJ46823, PWWP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060260: 79%, ENSRNOG00000036649: 77%
Entrez Gene ID: 170394
Uniprot ID: Q6NUJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL |
Gene ID - Mouse | ENSMUSG00000060260 |
Gene ID - Rat | ENSMUSG00000060260 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PWWP2B pAb (ATL-HPA078118) | |
Datasheet | Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link) |
Vendor Page | Anti PWWP2B pAb (ATL-HPA078118) at Atlas |
Documents & Links for Anti PWWP2B pAb (ATL-HPA078118) | |
Datasheet | Anti PWWP2B pAb (ATL-HPA078118) Datasheet (External Link) |
Vendor Page | Anti PWWP2B pAb (ATL-HPA078118) |