Protein Description: parvalbumin
Gene Name: PVALB
Alternative Gene Name: D22S749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005716: 88%, ENSRNOG00000006471: 94%
Entrez Gene ID: 5816
Uniprot ID: P20472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PVALB
Alternative Gene Name: D22S749
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005716: 88%, ENSRNOG00000006471: 94%
Entrez Gene ID: 5816
Uniprot ID: P20472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGK |
| Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) | |
| Datasheet | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) at Atlas |
| Documents & Links for Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) | |
| Datasheet | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PVALB pAb (ATL-HPA048536 w/enhanced validation) |