Protein Description: pseudouridylate synthase 3
Gene Name: PUS3
Alternative Gene Name: FKSG32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032103: 86%, ENSRNOG00000012994: 82%
Entrez Gene ID: 83480
Uniprot ID: Q9BZE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PUS3
Alternative Gene Name: FKSG32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032103: 86%, ENSRNOG00000012994: 82%
Entrez Gene ID: 83480
Uniprot ID: Q9BZE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DLRSQFPRGRDSEDFNVKEEANAAAEEIRYTHILNRVLPPDIRILAWAPVEPSFSARFSCLERTYRYFFPRADLDIVTMDYAAQKYVGTH |
| Documents & Links for Anti PUS3 pAb (ATL-HPA063802) | |
| Datasheet | Anti PUS3 pAb (ATL-HPA063802) Datasheet (External Link) |
| Vendor Page | Anti PUS3 pAb (ATL-HPA063802) at Atlas |
| Documents & Links for Anti PUS3 pAb (ATL-HPA063802) | |
| Datasheet | Anti PUS3 pAb (ATL-HPA063802) Datasheet (External Link) |
| Vendor Page | Anti PUS3 pAb (ATL-HPA063802) |