Protein Description: pseudouridine 5'-phosphatase
Gene Name: PUDP
Alternative Gene Name: DXF68S1E, FAM16AX, GS1, HDHD1, HDHD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048875: 68%, ENSRNOG00000025422: 73%
Entrez Gene ID: 8226
Uniprot ID: Q08623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PUDP
Alternative Gene Name: DXF68S1E, FAM16AX, GS1, HDHD1, HDHD1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048875: 68%, ENSRNOG00000025422: 73%
Entrez Gene ID: 8226
Uniprot ID: Q08623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGEPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPD |
| Documents & Links for Anti PUDP pAb (ATL-HPA072672) | |
| Datasheet | Anti PUDP pAb (ATL-HPA072672) Datasheet (External Link) |
| Vendor Page | Anti PUDP pAb (ATL-HPA072672) at Atlas |
| Documents & Links for Anti PUDP pAb (ATL-HPA072672) | |
| Datasheet | Anti PUDP pAb (ATL-HPA072672) Datasheet (External Link) |
| Vendor Page | Anti PUDP pAb (ATL-HPA072672) |