Anti PTX3 pAb (ATL-HPA069320)

Atlas Antibodies

Catalog No: ATL-HPA069320-25

• 

Product Description

Protein Description: pentraxin 3, long
Gene Name: PTX3
Alternative Gene Name: TNFAIP5, TSG-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027832: 85%, ENSRNOG00000012280: 90%
Entrez Gene ID: 5806
Uniprot ID: P26022
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
• Gene Sequence: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
• Gene ID - Mouse: ENSMUSG00000027832
• Gene ID - Rat: ENSRNOG00000012280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti PTX3 pAb (ATL-HPA069320) – 2 Found

Wang, Haichuan; Wang, Jingxiao; Zhang, Shanshan; Jia, Jiaoyuan; Liu, Xianqiong; Zhang, Jie; Wang, Pan; Song, Xinhua; Che, Li; Liu, Ke; Ribback, Silvia; Cigliano, Antonio; Evert, Matthias; Wu, Hong; Calvisi, Diego F; Zeng, Yong; Chen, Xin. Distinct and Overlapping Roles of Hippo Effectors YAP and TAZ During Human and Mouse Hepatocarcinogenesis. Cellular And Molecular Gastroenterology And Hepatology. 11(4):1095-1117. 

Aloy, Marie-Thérèse; Sidi Boumedine, Jacqueline; Deville, Agathe; Kryza, David; Gauthier, Arnaud; Brichart-Vernos, Delphine; Ollier, Grégoire; La Padula, Veronica; Lux, François; Tillement, Olivier; Rodriguez-Lafrasse, Claire; Janier, Marc. Proof of Concept of the Radiosensitizing Effect of Gadolinium Oxide Nanoparticles in Cell Spheroids and a Tumor-Implanted Murine Model of Chondrosarcoma. International Journal Of Nanomedicine. 17( 36582458):6655-6673.