Anti PTRF pAb (ATL-HPA074213)

Catalog No:
ATL-HPA074213-25
$395.00

Description

Product Description

Protein Description: polymerase I and transcript release factor
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 94%, ENSRNOG00000019778: 97%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Gene Sequence VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Gene ID - Mouse ENSMUSG00000004044
Gene ID - Rat ENSRNOG00000019778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PTRF pAb (ATL-HPA074213)
Datasheet Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA074213) at Atlas Antibodies

Documents & Links for Anti PTRF pAb (ATL-HPA074213)
Datasheet Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA074213)

Product Description

Protein Description: polymerase I and transcript release factor
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 94%, ENSRNOG00000019778: 97%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Gene Sequence VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD
Gene ID - Mouse ENSMUSG00000004044
Gene ID - Rat ENSRNOG00000019778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti PTRF pAb (ATL-HPA074213)
Datasheet Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA074213) at Atlas Antibodies

Documents & Links for Anti PTRF pAb (ATL-HPA074213)
Datasheet Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link)
Vendor Page Anti PTRF pAb (ATL-HPA074213)