Protein Description: polymerase I and transcript release factor
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 94%, ENSRNOG00000019778: 97%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTRF
Alternative Gene Name: cavin-1, CAVIN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004044: 94%, ENSRNOG00000019778: 97%
Entrez Gene ID: 284119
Uniprot ID: Q6NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VSVNVKTVRGSLERQAGQIKKLEVNEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSD |
| Documents & Links for Anti PTRF pAb (ATL-HPA074213) | |
| Datasheet | Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link) |
| Vendor Page | Anti PTRF pAb (ATL-HPA074213) at Atlas |
| Documents & Links for Anti PTRF pAb (ATL-HPA074213) | |
| Datasheet | Anti PTRF pAb (ATL-HPA074213) Datasheet (External Link) |
| Vendor Page | Anti PTRF pAb (ATL-HPA074213) |