Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation)

Catalog No:
ATL-HPA015103-25
$395.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: protein tyrosine phosphatase, receptor-type, Z polypeptide 1
Gene Name: PTPRZ1
Alternative Gene Name: phosphacan, PTP18, PTPRZ, PTPZ, RPTPB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068748: 68%, ENSRNOG00000006030: 72%
Entrez Gene ID: 5803
Uniprot ID: P23471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLIT
Gene Sequence LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLIT
Gene ID - Mouse ENSMUSG00000068748
Gene ID - Rat ENSRNOG00000006030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation)
Datasheet Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation) at Atlas

Documents & Links for Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation)
Datasheet Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation)

Citations for Anti PTPRZ1 pAb (ATL-HPA015103 w/enhanced validation) – 10 Found
Bershteyn, Marina; Nowakowski, Tomasz J; Pollen, Alex A; Di Lullo, Elizabeth; Nene, Aishwarya; Wynshaw-Boris, Anthony; Kriegstein, Arnold R. Human iPSC-Derived Cerebral Organoids Model Cellular Features of Lissencephaly and Reveal Prolonged Mitosis of Outer Radial Glia. Cell Stem Cell. 2017;20(4):435-449.e4.  PubMed
Liu, Wenying Angela; Chen, She; Li, Zhizhong; Lee, Choong Heon; Mirzaa, Ghayda; Dobyns, William B; Ross, M Elizabeth; Zhang, Jiangyang; Shi, Song-Hai. PARD3 dysfunction in conjunction with dynamic HIPPO signaling drives cortical enlargement with massive heterotopia. Genes & Development. 2018;32(11-12):763-780.  PubMed
Nakagawa, Naoki; Plestant, Charlotte; Yabuno-Nakagawa, Keiko; Li, Jingjun; Lee, Janice; Huang, Chu-Wei; Lee, Amelia; Krupa, Oleh; Adhikari, Aditi; Thompson, Suriya; Rhynes, Tamille; Arevalo, Victoria; Stein, Jason L; Molnár, Zoltán; Badache, Ali; Anton, E S. Memo1-Mediated Tiling of Radial Glial Cells Facilitates Cerebral Cortical Development. Neuron. 2019;103(5):836-852.e5.  PubMed
Bang-Christensen, Sara R; Pedersen, Rasmus S; Pereira, Marina A; Clausen, Thomas M; Løppke, Caroline; Sand, Nicolai T; Ahrens, Theresa D; Jørgensen, Amalie M; Lim, Yi Chieh; Goksøyr, Louise; Choudhary, Swati; Gustavsson, Tobias; Dagil, Robert; Daugaard, Mads; Sander, Adam F; Torp, Mathias H; Søgaard, Max; Theander, Thor G; Østrup, Olga; Lassen, Ulrik; Hamerlik, Petra; Salanti, Ali; Agerbæk, Mette Ø. Capture and Detection of Circulating Glioma Cells Using the Recombinant VAR2CSA Malaria Protein. Cells. 2019;8(9)  PubMed
Bhaduri, Aparna; Di Lullo, Elizabeth; Jung, Diane; Müller, Sören; Crouch, Elizabeth Erin; Espinosa, Carmen Sandoval; Ozawa, Tomoko; Alvarado, Beatriz; Spatazza, Julien; Cadwell, Cathryn René; Wilkins, Grace; Velmeshev, Dmitry; Liu, Siyuan John; Malatesta, Martina; Andrews, Madeline Gail; Mostajo-Radji, Mohammed Andres; Huang, Eric Jinsheng; Nowakowski, Tomasz Jan; Lim, Daniel Amos; Diaz, Aaron; Raleigh, David Ronan; Kriegstein, Arnold Richard. Outer Radial Glia-like Cancer Stem Cells Contribute to Heterogeneity of Glioblastoma. Cell Stem Cell. 2020;26(1):48-63.e6.  PubMed
Shao, Wei; Yang, Jiajun; He, Ming; Yu, Xiang-Yu; Lee, Choong Heon; Yang, Zhaohui; Joyner, Alexandra L; Anderson, Kathryn V; Zhang, Jiangyang; Tsou, Meng-Fu Bryan; Shi, Hang; Shi, Song-Hai. Centrosome anchoring regulates progenitor properties and cortical formation. Nature. 2020;580(7801):106-112.  PubMed
Yamanoi, Yu; Fujii, Masazumi; Murakami, Yuta; Nagai, Kenichiro; Hoshi, Kyoka; Hashimoto, Yasuhiro; Honda, Takashi; Saito, Kiyoshi; Kitazume, Shinobu. Soluble protein tyrosine phosphatase receptor type Z (PTPRZ) in cerebrospinal fluid is a potential diagnostic marker for glioma. Neuro-Oncology Advances. 2020;2(1):vdaa055.  PubMed
Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995.  PubMed
Lam, K H Brian; Leon, Alberto J; Hui, Weili; Lee, Sandy Che-Eun; Batruch, Ihor; Faust, Kevin; Klekner, Almos; Hutóczki, Gábor; Koritzinsky, Marianne; Richer, Maxime; Djuric, Ugljesa; Diamandis, Phedias. Topographic mapping of the glioblastoma proteome reveals a triple-axis model of intra-tumoral heterogeneity. Nature Communications. 2022;13(1):116.  PubMed
Fischer, Jan; Fernández Ortuño, Eduardo; Marsoner, Fabio; Artioli, Annasara; Peters, Jula; Namba, Takashi; Eugster Oegema, Christina; Huttner, Wieland B; Ladewig, Julia; Heide, Michael. Human-specific ARHGAP11B ensures human-like basal progenitor levels in hominid cerebral organoids. Embo Reports. 2022;23(11):e54728.  PubMed