Protein Description: protein tyrosine phosphatase, receptor type, R
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 83%, ENSRNOG00000004483: 84%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTPRR
Alternative Gene Name: EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020151: 83%, ENSRNOG00000004483: 84%
Entrez Gene ID: 5801
Uniprot ID: Q15256
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE |
| Documents & Links for Anti PTPRR pAb (ATL-HPA011851) | |
| Datasheet | Anti PTPRR pAb (ATL-HPA011851) Datasheet (External Link) |
| Vendor Page | Anti PTPRR pAb (ATL-HPA011851) at Atlas |
| Documents & Links for Anti PTPRR pAb (ATL-HPA011851) | |
| Datasheet | Anti PTPRR pAb (ATL-HPA011851) Datasheet (External Link) |
| Vendor Page | Anti PTPRR pAb (ATL-HPA011851) |