Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation)

Catalog No:
ATL-HPA000440-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: protein tyrosine phosphatase, receptor type C
Gene Name: PTPRC
Alternative Gene Name: PTPRC, GP180, LCA, T200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026395: 35%, ENSRNOG00000000655: 37%
Entrez Gene ID: 5788
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT

Documents & Links for Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation)
Datasheet Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation) at Atlas

Documents & Links for Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation)
Datasheet Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation)

Citations for Anti PTPRC pAb (ATL-HPA000440 w/enhanced validation) – 3 Found
Silva, Virgílio Souza E; Abdallah, Emne Ali; Flores, Bianca de Cássia Troncarelli; Braun, Alexcia Camila; Costa, Daniela de Jesus Ferreira; Ruano, Anna Paula Carreta; Gasparini, Vanessa Alves; Silva, Maria Letícia Gobo; Mendes, Gustavo Gomes; Claro, Laura Carolina Lopez; Calsavara, Vinicius Fernando; Aguiar Junior, Samuel; de Mello, Celso Abdon Lopes; Chinen, Ludmilla Thomé Domingos. Molecular and Dynamic Evaluation of Proteins Related to Resistance to Neoadjuvant Treatment with Chemoradiotherapy in Circulating Tumor Cells of Patients with Locally Advanced Rectal Cancer. Cells. 2021;10(6)  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Edlund, Karolina; Lindskog, Cecilia; Saito, Akira; Berglund, Anders; Pontén, Fredrik; Göransson-Kultima, Hanna; Isaksson, Anders; Jirström, Karin; Planck, Maria; Johansson, Leif; Lambe, Mats; Holmberg, Lars; Nyberg, Fredrik; Ekman, Simon; Bergqvist, Michael; Landelius, Per; Lamberg, Kristina; Botling, Johan; Ostman, Arne; Micke, Patrick. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. International Journal Of Cancer. 2012;131(10):2264-73.  PubMed