Protein Description: protein tyrosine phosphatase, receptor type, A
Gene Name: PTPRA
Alternative Gene Name: HLPR, HPTPA, LRP, PTPA, PTPRL2, RPTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027303: 80%, ENSRNOG00000021223: 80%
Entrez Gene ID: 5786
Uniprot ID: P18433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: PTPRA
Alternative Gene Name: HLPR, HPTPA, LRP, PTPA, PTPRL2, RPTPA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027303: 80%, ENSRNOG00000021223: 80%
Entrez Gene ID: 5786
Uniprot ID: P18433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPP |
Documents & Links for Anti PTPRA pAb (ATL-HPA069480) | |
Datasheet | Anti PTPRA pAb (ATL-HPA069480) Datasheet (External Link) |
Vendor Page | Anti PTPRA pAb (ATL-HPA069480) at Atlas |
Documents & Links for Anti PTPRA pAb (ATL-HPA069480) | |
Datasheet | Anti PTPRA pAb (ATL-HPA069480) Datasheet (External Link) |
Vendor Page | Anti PTPRA pAb (ATL-HPA069480) |